CONTRIBUTE
Sites: 216.82 M (+5)
| Directory: 951 sites (+2)
| Niches: 7320 (0)
| Updates: 89.62 M sites/month
| Suggestions: 63 (+3)
SHARE
Share this W3DIR page on Facebook
Share this W3DIR page on Twitter
SHARE

LEVEL DOMAIN: .COM.

Ranking list of active websites with .com extension ordered by Alexa Rank. List updated monthly with new statistics and websites.

List created in: 2019-09-02

Showing 5016801 - 5016900 of 50,829,081

DOMAIN CATEGORY SUBCATEGORY ALEXA RANK
View swagbeautybar.com details swagbeautybar.com Not selected Not selected N/A Show more info
View vailpestcontrol.com details vailpestcontrol.com Not selected Not selected N/A Show more info
View mqf8888.com details mqf8888.com Not selected Not selected N/A Show more info
View petrosbleyan.com details petrosbleyan.com Not selected Not selected N/A Show more info
View swbradio.com details swbradio.com Not selected Not selected N/A Show more info
View valentinousa.com details valentinousa.com Not selected Not selected N/A Show more info
View 9yzz.com details 9yzz.com Not selected Not selected N/A Show more info
View yucezhuanjia.com details yucezhuanjia.com Not selected Not selected N/A Show more info
View a104.com details a104.com Not selected Not selected N/A Show more info
View leeslites.com details leeslites.com Not selected Not selected N/A Show more info
View pfxbh.com details pfxbh.com Not selected Not selected N/A Show more info
View yukiyoneda.com details yukiyoneda.com Not selected Not selected N/A Show more info
View a3or.com details a3or.com Not selected Not selected N/A Show more info
View benjaminblanchy.com details benjaminblanchy.com Not selected Not selected N/A Show more info
View bentboybooks.com details bentboybooks.com Not selected Not selected N/A Show more info
View getmefiredup.com details getmefiredup.com Not selected Not selected N/A Show more info
View legendsmedieval.com details legendsmedieval.com Not selected Not selected N/A Show more info
View yuritzy2lands.com details yuritzy2lands.com Not selected Not selected N/A Show more info
View bereanonline.com details bereanonline.com Not selected Not selected N/A Show more info
View ebhcqueries.com details ebhcqueries.com Not selected Not selected N/A Show more info
View lehygienemerde.com details lehygienemerde.com Not selected Not selected N/A Show more info
View philadelphianewhomesource.com details philadelphianewhomesource.com Not selected Not selected N/A Show more info
View getvived.com details getvived.com Not selected Not selected N/A Show more info
View mtbf-software.com details mtbf-software.com Not selected Not selected N/A Show more info
View syahrulsyaputra.com details syahrulsyaputra.com Not selected Not selected N/A Show more info
View club-europole.com details club-europole.com Not selected Not selected N/A Show more info
View inhibitedthoughts.com details inhibitedthoughts.com Not selected Not selected N/A Show more info
View lensprotect.com details lensprotect.com Not selected Not selected N/A Show more info
View phonelookupwizard.com details phonelookupwizard.com Not selected Not selected N/A Show more info
View vaypor.com details vaypor.com Not selected Not selected N/A Show more info
View abctherapyltd.com details abctherapyltd.com Not selected Not selected N/A Show more info
View bestabilifysuit.com details bestabilifysuit.com Not selected Not selected N/A Show more info
View abfusa.com details abfusa.com Not selected Not selected N/A Show more info
View bestclaimcompanies.com details bestclaimcompanies.com Not selected Not selected N/A Show more info
View ecomputerneeds.com details ecomputerneeds.com Not selected Not selected N/A Show more info
View inmydotage.com details inmydotage.com Not selected Not selected N/A Show more info
View mulliganinc.com details mulliganinc.com Not selected Not selected N/A Show more info
View ablecommercedemo.com details ablecommercedemo.com Not selected Not selected N/A Show more info
View giftaro.com details giftaro.com Not selected Not selected N/A Show more info
View abrd-digital.com details abrd-digital.com Not selected Not selected N/A Show more info
View gilmeup.com details gilmeup.com Not selected Not selected N/A Show more info
View t-linked.com details t-linked.com Not selected Not selected N/A Show more info
View coachcovington.com details coachcovington.com Not selected Not selected N/A Show more info
View edkashistock.com details edkashistock.com Not selected Not selected N/A Show more info
View inspiremyroom.com details inspiremyroom.com Not selected Not selected N/A Show more info
View leyinba.com details leyinba.com Not selected Not selected N/A Show more info
View tabletopcoin.com details tabletopcoin.com Not selected Not selected N/A Show more info
View tacticalpilot.com details tacticalpilot.com Not selected Not selected N/A Show more info
View acec-gch.com details acec-gch.com Not selected Not selected N/A Show more info
View bevimport.com details bevimport.com Not selected Not selected N/A Show more info
View codemasterbill.com details codemasterbill.com Not selected Not selected N/A Show more info
View gk2designs.com details gk2designs.com Not selected Not selected N/A Show more info
View pinkims.com details pinkims.com Not selected Not selected N/A Show more info
View achandymanservices.com details achandymanservices.com Not selected Not selected N/A Show more info
View bfky.com details bfky.com Not selected Not selected N/A Show more info
View intercessionpourlesfamilles.com details intercessionpourlesfamilles.com Not selected Not selected N/A Show more info
View librosdefrozen.com details librosdefrozen.com Not selected Not selected N/A Show more info
View my-tempo-team.com details my-tempo-team.com Not selected Not selected N/A Show more info
View takinglove.com details takinglove.com Not selected Not selected N/A Show more info
View vfd9.com details vfd9.com Not selected Not selected N/A Show more info
View zgzhongqingkeji.com details zgzhongqingkeji.com Not selected Not selected N/A Show more info
View egyptbest.com details egyptbest.com Not selected Not selected N/A Show more info
View lidianaecesar.com details lidianaecesar.com Not selected Not selected N/A Show more info
View myanmarexporter.com details myanmarexporter.com Not selected Not selected N/A Show more info
View satins.com details satins.com Not selected Not selected N/A Show more info
View colectivolabs.com details colectivolabs.com Not selected Not selected N/A Show more info
View global-but-local.com details global-but-local.com Not selected Not selected N/A Show more info
View bhttechnology.com details bhttechnology.com Not selected Not selected N/A Show more info
View globalestatessales.com details globalestatessales.com Not selected Not selected N/A Show more info
View vickymitosis.com details vickymitosis.com Not selected Not selected N/A Show more info
View collegeparkinvestigator.com details collegeparkinvestigator.com Not selected Not selected N/A Show more info
View ejderha.com details ejderha.com Not selected Not selected N/A Show more info
View interviewsex.com details interviewsex.com Not selected Not selected N/A Show more info
View colomichigan.com details colomichigan.com Not selected Not selected N/A Show more info
View adamsartappraisals.com details adamsartappraisals.com Not selected Not selected N/A Show more info
View tantrichoneymoon.com details tantrichoneymoon.com Not selected Not selected N/A Show more info
View myflyecardnow.com details myflyecardnow.com Not selected Not selected N/A Show more info
View vietnamgrear.com details vietnamgrear.com Not selected Not selected N/A Show more info
View zipbg.com details zipbg.com Not selected Not selected N/A Show more info
View adhdtraveler.com details adhdtraveler.com Not selected Not selected N/A Show more info
View comercialpolzan.com details comercialpolzan.com Not selected Not selected N/A Show more info
View gnosticcentre.com details gnosticcentre.com Not selected Not selected N/A Show more info
View ionicapetroli.com details ionicapetroli.com Not selected Not selected N/A Show more info
View goairportcars.com details goairportcars.com Not selected Not selected N/A Show more info
View iowatiresales.com details iowatiresales.com Not selected Not selected N/A Show more info
View elementfunds.com details elementfunds.com Not selected Not selected N/A Show more info
View lindsaygtanner.com details lindsaygtanner.com Not selected Not selected N/A Show more info
View tavanatarkhis.com details tavanatarkhis.com Not selected Not selected N/A Show more info
View zoctalks.com details zoctalks.com Not selected Not selected N/A Show more info
View adstage.com details adstage.com Not selected Not selected N/A Show more info
View company-worx.com details company-worx.com Not selected Not selected N/A Show more info
View eligrand.com details eligrand.com Not selected Not selected N/A Show more info
View mynordiclove.com details mynordiclove.com Not selected Not selected N/A Show more info
View vinyllinerreplacementtampafl.com details vinyllinerreplacementtampafl.com Not selected Not selected N/A Show more info
View bingiecorner.com details bingiecorner.com Not selected Not selected N/A Show more info
View elitecodersgroup.com details elitecodersgroup.com Not selected Not selected N/A Show more info
View linximengneiyi.com details linximengneiyi.com Not selected Not selected N/A Show more info
View scienceofmunch.com details scienceofmunch.com Not selected Not selected N/A Show more info
View tbniu.com details tbniu.com Not selected Not selected N/A Show more info
View ellcoshowgun.com details ellcoshowgun.com Not selected Not selected N/A Show more info